PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03647g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NAC
Protein Properties Length: 329aa    MW: 36551.1 Da    PI: 9.6222
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03647g00005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM95.39.3e-3088352128
                       NAM  52 kaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                ++++ew+fFs+r +ky++g++++rat++gyWkatgk+++v+s +++ +g+k+tLvf++grapkg++t+W+mhey +
  Peinf101Scf03647g00005.1   8 IQSDNEWFFFSPRGRKYPNGSQSKRATETGYWKATGKERNVKS-GSNIIGTKRTLVFHTGRAPKGQRTQWIMHEYCM 83 
                               45789**************************************.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.3671101IPR003441NAC domain
SuperFamilySSF1019411.96E-346100IPR003441NAC domain
PfamPF023652.2E-141182IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MLSAKSVIQS DNEWFFFSPR GRKYPNGSQS KRATETGYWK ATGKERNVKS GSNIIGTKRT  60
LVFHTGRAPK GQRTQWIMHE YCMSGNTNHQ DSMVVCRLRK NSEFHLNDTP RNRRNQLAAT  120
DSATAMSGAG QLGSLELVTG GDCCSKEGSS SFHSHSVEQI DSESESDNPT KEFSQHDSSS  180
HFKDCDGEED CFADIMKDDI IKLDDSSFNA RPVSMVSSGP ESSNISTREA QVTLSNVVPF  240
QGTANRRLRL VREKVVGYRV EGSKVHAATK KNKIGTSTTG SASWLRNTFS VKRMKQYTIP  300
IFLITLIVLV MFVFLLGCSP QRLHILTSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-251110173168NAC domain-containing protein 19
3swm_B2e-251110173168NAC domain-containing protein 19
3swm_C2e-251110173168NAC domain-containing protein 19
3swm_D2e-251110173168NAC domain-containing protein 19
3swp_A2e-251110173168NAC domain-containing protein 19
3swp_B2e-251110173168NAC domain-containing protein 19
3swp_C2e-251110173168NAC domain-containing protein 19
3swp_D2e-251110173168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-110HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361089.10.0PREDICTED: NAC domain-containing protein 89-like isoform X1
RefseqXP_015170624.10.0PREDICTED: NAC domain-containing protein 89-like isoform X2
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.12e-51NAC domain containing protein 89